{"title":"Tab Filters","description":"","products":[{"product_id":"igf-des-2mg","title":"IGF-DES 2mg","description":"IGF-DES (Insulin-Like Growth Factor-1 DES)\nOverview\nIGF-DES is a truncated form of IGF-1, which has 3-10 times higher potency in muscle growth and repair due to its enhanced receptor binding and reduced binding protein affinity.\nKey Benefits:\n✔ Rapid muscle growth and hypertrophy\n✔ Increased nitrogen retention and protein synthesis\n✔ Enhances endurance and recovery\n✔ Works locally at the site of injection\nMechanism of Action:\n\nIGF-DES bypasses IGF binding proteins, increasing its potency in muscle and tissue growth.\nStimulates hyperplasia (new muscle cell formation), unlike regular IGF-1, which only promotes hypertrophy.\n\nCitations:\n\nAdams, G. R. et al. “IGF-1 variants and their role in muscle regeneration,” J Appl Physiol, 2010.\nYang, S. Y. et al. “IGF-DES vs. IGF-1 in skeletal muscle growth,” J Cell Physiol, 2015.","brand":"Biogenesis Peptides","offers":[{"title":"Default Title","offer_id":50989560692969,"sku":"PS050","price":20000.0,"currency_code":"PKR","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0808\/6559\/1529\/files\/IGF-DES-2MG-scaled.jpg?v=1778509474"},{"product_id":"ghrp-6-5mg","title":"GHRP-6 5mg","description":"\u003cp\u003eOVERVIEW\u003cbr\u003e\nGHRP-6 (Growth Hormone-Releasing Peptide-6) is a synthetic peptide that stimulates growth hormone (GH) release by acting as a ghrelin receptor agonist. It has been extensively studied for its potential benefits in appetite regulation, tissue repair, cognitive function, and cardiovascular health.\u003cbr\u003e\nResearch suggests GHRP-6 may:\u003c\/p\u003e\n\n\u003cp\u003eEnhance memory and cognitive function, supporting long-term memory formation.\u003cbr\u003e\nPromote neuroprotection, reducing inflammation and cell death in brain tissue.\u003cbr\u003e\nAccelerate skin and wound healing, increasing collagen production and reducing scar formation.\u003cbr\u003e\nProtect heart tissue, minimizing oxidative stress and damage following myocardial infarction.\u003cbr\u003e\nRegulate mood and sexual motivation, possibly reducing symptoms of depression and stress.\u003cbr\u003e\nSupport metabolic balance, potentially influencing obesity and energy homeostasis.\u003c\/p\u003e\n\n\u003cp\u003eDue to these properties, GHRP-6 has potential therapeutic applications in neurological disorders, cardiovascular health, and tissue regeneration.\u003cbr\u003e\nRESEARCH\u003cbr\u003e\nGHRP-6 and Cognitive Function\u003c\/p\u003e\n\n\u003cp\u003eStudies suggest GHRP-6 enhances memory formation and spatial learning, indicating potential cognitive benefits.\u003cbr\u003e\nMay aid in converting short-term memories into long-term storage, improving overall cognitive performance.\u003cbr\u003e\nPotential application: Treatment for age-related cognitive decline and neurodegenerative disorders.\u003c\/p\u003e\n\n\u003cp\u003eGHRP-6 and Neuroprotection\u003c\/p\u003e\n\n\u003cp\u003eResearch indicates that GHRP-6 reduces inflammation and prevents apoptosis (programmed cell death) in brain tissue.\u003cbr\u003e\nMay play a role in stroke recovery and neurodegenerative diseases such as Parkinson’s disease.\u003cbr\u003e\nPotential application: Neuroprotection and post-stroke rehabilitation.\u003c\/p\u003e\n\n\u003cp\u003eGHRP-6 and Skin Healing\u003c\/p\u003e\n\n\u003cp\u003eGHRP-6 has been found to promote tissue regeneration and enhance wound closure.\u003cbr\u003e\nIncreases collagen production, reducing the risk of hypertrophic scarring.\u003cbr\u003e\nPotential application: Treatment for burn injuries, post-surgical healing, and chronic wounds.\u003c\/p\u003e\n\n\u003cp\u003eGHRP-6 and Cardiovascular Benefits\u003c\/p\u003e\n\n\u003cp\u003eStudies in animal models suggest GHRP-6 reduces heart damage following a myocardial infarction (heart attack).\u003cbr\u003e\nMay protect heart cells from oxidative stress, improving cardiac function.\u003cbr\u003e\nPotential application: Cardioprotection and post-heart attack recovery.\u003c\/p\u003e\n\n\u003cp\u003eGHRP-6 and Mood Regulation\u003c\/p\u003e\n\n\u003cp\u003eResearch in rats suggests that GHRP-6 influences sexual motivation and mood by interacting with ghrelin receptors in the brain.\u003cbr\u003e\nMay help regulate symptoms of depression and stress, offering mood-enhancing benefits.\u003cbr\u003e\nPotential application: Mental health support and stress management.\u003c\/p\u003e\n\n\u003cp\u003eGHRP-6 and Metabolism\u003c\/p\u003e\n\n\u003cp\u003eGHRP-6 has been investigated for its role in regulating metabolism, particularly in growth hormone secretion and energy balance.\u003cbr\u003e\nPotential application: Treatment for metabolic disorders and obesity management.\u003c\/p\u003e\n\n\u003cp\u003eSTRUCTURE\u003c\/p\u003e\n\n\u003cp\u003eMolecular Formula: C₄₆H₅₆N₁₂O₆\u003cbr\u003e\nMolecular Weight: 873.032 g\/mol\u003cbr\u003e\nAmino Acid Sequence: His-D-Trp-Ala-Trp-D-Phe-Lys\u003cbr\u003e\nCAS Registry Number: 87616-84-0\u003cbr\u003e\nMechanism of Action: GHRP-6 binds to the ghrelin receptor (GHS-R1a) in the hypothalamus and pituitary gland, stimulating growth hormone release, which enhances cell growth, tissue repair, and metabolic function.\u003c\/p\u003e\n\n\u003cp\u003eCITATIONS\u003c\/p\u003e\n\n\u003cp\u003eHuang, C.-C., Chou, D., Yeh, C.-M., \u0026amp; Hsu, K.-S. Acute food deprivation enhances fear extinction but inhibits long-term depression in the lateral amygdala via ghrelin signaling. Neuropharmacology (2016).\u003cbr\u003e\nBeheshti, S., \u0026amp; Shahrokhi, S. Blocking the ghrelin receptor type 1a in the rat brain impairs memory encoding.Neuropeptides (2015).\u003cbr\u003e\nTóth, K., László, K., \u0026amp; Lénárd, L. Role of intraamygdaloid acylated-ghrelin in spatial learning. Brain Res. Bull. (2010).\u003cbr\u003e\nSubirós, N. et al. (Additional references pending completion)\u003c\/p\u003e","brand":"Biogenesis Peptides","offers":[{"title":"Default Title","offer_id":50989560922345,"sku":"PS041","price":20000.0,"currency_code":"PKR","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0808\/6559\/1529\/files\/GHRP6-5MG-scaled.jpg?v=1778509480"},{"product_id":"epithalon-10mg","title":"Epithalon 10mg","description":"Epithalon (Epitalon) Peptide\nOverview\nEpithalon (also known as Epitalon) is a synthetic tetrapeptide derived from Epithalamin, a naturally occurring peptide in the pineal gland. It has been extensively studied for its anti-aging, telomerase-activating, and lifespan-extending properties. Epithalon is primarily known for its ability to:\n✔ Activate telomerase, promoting DNA repair and longevity\n✔ Enhance melatonin production, regulating circadian rhythms and sleep\n✔ Reduce oxidative stress and inflammation\n✔ Support immune function and cellular repair\n✔ Improve cardiovascular and metabolic health\nMechanism of Action\n1. Telomerase Activation \u0026amp; Longevity\n\nTelomeres shorten with age, leading to cellular aging and senescence.\nEpithalon activates telomerase, the enzyme responsible for lengthening telomeres and enhancing cellular longevity.\nStudies in mice and primates showed increased lifespan by up to 30% after Epithalon administration.\n\n2. Melatonin Production \u0026amp; Circadian Rhythm Regulation\n\nEpithalon enhances melatonin synthesis, improving sleep quality, mood regulation, and hormonal balance.\nRegulates the pineal gland, maintaining youthful endocrine function.\n\n3. Immune System \u0026amp; Cellular Protection\n\nIncreases T-cell activity and reduces age-related immune decline.\nProtects against oxidative stress by neutralizing free radicals, reducing inflammation, and supporting DNA repair.\nImproves mitochondrial function, enhancing cellular energy production (ATP synthesis).\n\n4. Cancer Prevention \u0026amp; DNA Repair\n\nEpithalon has been studied for its anti-cancer effects, showing anti-tumor activity by inhibiting cancer cell proliferation.\nPromotes DNA integrity, reducing age-related mutations.\n\nResearch \u0026amp; Clinical Applications\n1. Telomerase Activation \u0026amp; Lifespan Extension\n\nStudies in rats, mice, and primates show telomere elongation and up to 30% lifespan increase.\nResearch suggests potential anti-aging applications in humans.\n\n2. Neuroprotection \u0026amp; Cognitive Benefits\n\nEpithalon enhances neuronal plasticity, improving memory, focus, and cognitive function.\nProtects against neurodegeneration in models of Alzheimer’s and Parkinson’s disease.\n\n3. Cardiovascular Health\n\nReduces oxidative stress and arterial plaque formation, lowering the risk of heart disease and stroke.\nEnhances blood vessel function and prevents hypertension-related damage.\n\n4. Cancer Prevention \u0026amp; DNA Protection\n\nStudies in breast, colon, and lung cancer models show reduced tumor growth and improved immune surveillance.\nEpithalon has been studied as a potential co-therapy in oncology.\n\n5. Sleep Optimization \u0026amp; Hormonal Balance\n\nRestores melatonin secretion, improving sleep quality and circadian rhythm stability.\nHelps regulate cortisol and stress response, reducing age-related hormonal imbalances.\n\nStructure \u0026amp; Composition\n\nSequence: Ala-Glu-Asp-Gly\nMolecular Formula: C₁₄H₂₂N₄O₉\nMolecular Weight: 390.35 g\/mol\nCAS Number: 307297-39-8\n\nCitations \u0026amp; References\n\nKhavinson, V. et al. “Peptide regulation of aging: Epithalon as a geroprotector,” Biogerontology, 2011.\nAnisimov, V. N. et al. “Effect of Epithalon on telomerase activity and life span in mice,” Neuroendocrinology Letters, 2003.\nTurchaninova, M. F. et al. “Pineal peptides restore age-related melatonin decline in humans,” Clinical and Experimental Pharmacology and Physiology, 2015.\nKhavinson, V. et al. “Epithalon’s effect on telomere length and longevity in human cell cultures,” Rejuvenation Research, 2005.\nLustgarten, M. S. et al. “Mitochondrial dysfunction in aging: Role of oxidative stress and epithalon,” Nature Aging Research, 2019.\nDePinho, R. A. “The telomere theory of aging and its implications for human longevity,” Cell Metabolism, 2009.\nAnisimov, V. N. et al. “Epithalon as a potential anti-cancer therapy: Experimental models and clinical applications,” Oncology Reports, 2006.\n\nConclusion\nEpithalon is one of the most promising anti-aging peptides, backed by decades of research on telomere extension, mitochondrial function, immune support, and cancer prevention. Its ability to activate telomerase, regulate melatonin, and enhance DNA repair makes it a powerful candidate for longevity research, neuroprotection, and age-related disease prevention.","brand":"Biogenesis Peptides","offers":[{"title":"Default Title","offer_id":50989561020649,"sku":"PS036","price":20000.0,"currency_code":"PKR","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0808\/6559\/1529\/files\/EPITHALON-10MG-scaled.jpg?v=1778509483"},{"product_id":"dsip-5mg","title":"DSIP 5mg","description":"\u003cp\u003eOVERVIEW\u003cbr\u003e\nDelta Sleep-Inducing Peptide (DSIP) is a naturally occurring neuropeptide, first discovered in 1977, that plays a role in sleep regulation, stress response, and metabolic function. Although initially studied for its sleep-promoting effects, research suggests that DSIP has a wide range of physiological and endocrine functions beyond sleep.\u003cbr\u003e\nStudies indicate that DSIP may:\u003c\/p\u003e\n\n\u003cp\u003eReduce oxidative stress and support mitochondrial function.\u003cbr\u003e\nImprove heart function by normalizing myocardial contractility.\u003cbr\u003e\nRegulate stress response and lower cortisol levels.\u003cbr\u003e\nModulate pain perception and opioid receptor activity.\u003cbr\u003e\nInfluence blood pressure and metabolic processes.\u003cbr\u003e\nShow potential in treating major depressive disorder (MDD).\u003c\/p\u003e\n\n\u003cp\u003eWhile DSIP was originally thought to induce sleep, research has produced mixed results, with some studies confirming sleep benefits and others suggesting it plays a regulatory role rather than directly causing sedation.\u003cbr\u003e\nRESEARCH\u003cbr\u003e\nDSIP and Sleep Regulation\u003c\/p\u003e\n\n\u003cp\u003eDSIP was named for its ability to induce sleep in rabbits.\u003cbr\u003e\nHuman studies have shown inconsistent results—some report improved sleep quality, while others found no direct sedative effect.\u003cbr\u003e\nDSIP may help regulate sleep cycles rather than act as a traditional sedative.\u003cbr\u003e\nEEG studies have shown both increased slow-wave sleep and no effect, indicating complex sleep interactions.\u003cbr\u003e\nDSIP is being researched for its potential in managing chronic insomnia.\u003c\/p\u003e\n\n\u003cp\u003eDSIP and Pain Modulation\u003c\/p\u003e\n\n\u003cp\u003eAnimal studies show that DSIP reduces pain sensitivity.\u003cbr\u003e\nActs on central opioid receptors, providing analgesic effects without opioid dependence.\u003cbr\u003e\nHuman trials suggest DSIP may help reduce chronic pain perception and ease opioid withdrawal symptoms.\u003cbr\u003e\nDSIP appears to influence serotonin and dopamine activity, which are critical for pain regulation.\u003c\/p\u003e\n\n\u003cp\u003eDSIP and Stress Reduction\u003c\/p\u003e\n\n\u003cp\u003eDSIP has been shown to lower cortisol levels, helping to modulate the body’s stress response.\u003cbr\u003e\nResearch suggests DSIP inhibits somatostatin, a peptide involved in stress and hormone regulation.\u003cbr\u003e\nAnimal models of chronic stress indicate DSIP helps normalize metabolic disruptions.\u003cbr\u003e\nPotential applications in PTSD and anxiety disorders are under investigation.\u003c\/p\u003e\n\n\u003cp\u003eDSIP and Metabolic Regulation\u003c\/p\u003e\n\n\u003cp\u003eDSIP may support mitochondrial function, protecting against oxidative stress and metabolic dysfunction.\u003cbr\u003e\nResearch suggests DSIP helps prevent metabolic damage during stroke and heart attacks by maintaining cellular energy production.\u003c\/p\u003e\n\n\u003cp\u003eDSIP and Depression Treatment\u003c\/p\u003e\n\n\u003cp\u003eLow DSIP levels have been observed in individuals with major depressive disorder (MDD).\u003cbr\u003e\nDSIP influences monoamine oxidase type A (MAO-A) and serotonin, both key targets for depression treatment.\u003cbr\u003e\nEarly studies suggest DSIP may help stabilize mood and reduce suicidal tendencies.\u003c\/p\u003e\n\n\u003cp\u003eDSIP and Withdrawal Management\u003c\/p\u003e\n\n\u003cp\u003eDSIP has been studied for its potential to ease withdrawal symptoms in alcohol and opioid detoxification.\u003cbr\u003e\nStudy in 107 patients found:\u003c\/p\u003e\n\n\u003cp\u003e97% of alcohol-dependent patients showed significant improvement.\u003cbr\u003e\n87% of opioid-dependent patients experienced substantial symptom relief.\u003c\/p\u003e\n\n\n\u003cp\u003eMore frequent dosing was required for opioid withdrawal, but overall results were promising.\u003c\/p\u003e\n\n\u003cp\u003eDSIP and Cancer Prevention\u003c\/p\u003e\n\n\u003cp\u003eAnimal studies suggest a 2.6-fold reduction in tumor development with DSIP treatment.\u003cbr\u003e\nDSIP-treated mice exhibited a 22.6% reduction in chromosomal abnormalities, suggesting potential anti-cancer properties.\u003cbr\u003e\nFurther research is needed to determine whether DSIP directly prevents cancer or if its benefits are due to overall stress reduction and metabolic regulation.\u003c\/p\u003e\n\n\u003cp\u003eSTRUCTURE\u003c\/p\u003e\n\n\u003cp\u003eMolecular Formula: C₃₅H₄₈N₁₀O₁₅\u003cbr\u003e\nMolecular Weight: 848.824 g\/mol\u003cbr\u003e\nAmino Acid Sequence: Trp-Ala-Gly-Gly-Asp-Ala-Ser-Gly-Glu\u003cbr\u003e\nCAS Registry Number: 62568-57-4\u003cbr\u003e\nPubChem Identifier: 68816\u003cbr\u003e\nSynonyms: Emideltide, DSIP nonapeptide, Deltaran\u003c\/p\u003e\n\n\u003cp\u003eCITATIONS\u003c\/p\u003e\n\n\u003cp\u003eGraf M., Christen H., Schoenenberger G. DSIP\/DSIP-P and circadian motor activity of rats under continuous light. Peptides (1982).\u003cbr\u003e\nYehuda S., Kastin A. J., Coy D. H. Thermoregulatory and locomotor effects of DSIP: Paradoxical interaction with d-amphetamine. Pharmacology Biochemistry and Behavior (1980).\u003cbr\u003e\nSinyukhin A. B. et al. Delta sleep-inducing peptide analogue corrects CNS functional state in children treated with chemotherapy. Eur. Neuropsychopharmacol. (2009).\u003cbr\u003e\nKoplik E. V. et al. Delta sleep-inducing peptide and Deltaran: Potential approaches to antistress protection.Neurosci. Behav. Physiol. (2008).\u003cbr\u003e\nFeller L., Khammissa R. A. G., Lemmer J. Basal cell carcinoma, squamous cell carcinoma, and melanoma of the head and face. Head \u0026amp; Face Medicine (2016).\u003cbr\u003e\nMcMillan T. R. et al. Melanotan II, a melanocortin agonist, partially rescues the impaired thermogenic capacity of pituitary adenylate cyclase-activating polypeptide deficient mice. Exp. Physiol. (2021).\u003cbr\u003e\nJetté L. et al. Effect of DSIP-containing preparation Deltaran on biomarkers of aging, lifespan, and spontaneous tumor incidence in mice. PubMed (2005).\u003cbr\u003e\nWessells H., Levine L. A. Evaluation of the efficacy of DSIP in psychogenic erectile dysfunction. J. Sex Med. (2012).\u003cbr\u003e\nFowkes M. M. et al. Peptidomimetic DSIP derivatives for PET imaging. Eur. J. Med. Chem. (2018).\u003c\/p\u003e","brand":"Biogenesis Peptides","offers":[{"title":"Default Title","offer_id":50989561151721,"sku":"PS032","price":20000.0,"currency_code":"PKR","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0808\/6559\/1529\/files\/DSIP-5MG-scaled.jpg?v=1778509486"},{"product_id":"cjc-1295-dac-5mg","title":"CJC-1295 DAC 5mg","description":"OVERVIEW\nCJC-1295 is a synthetic analogue of growth hormone-releasing hormone (GHRH) designed to increase plasma levels of growth hormone (GH) and insulin-like growth factor-1 (IGF-1). It is derived from the first 29 amino acids of GHRH, similar to Sermorelin and Modified GRF (1-29), but modified for enhanced stability and efficacy.\nThe DAC (Drug Affinity Complex) version of CJC-1295 includes an additional lysine linker, allowing it to bind to albumin, significantly extending its half-life. This prolonged activity leads to sustained GH release, reducing the need for frequent dosing compared to non-DAC versions.\nKey Benefits of CJC-1295 DAC:\n\nIncreases GH and IGF-1 levels\nEnhances protein synthesis and muscle recovery\nBoosts fat metabolism and supports weight management\nImproves sleep quality and cognitive function\nPreserves natural GH pulsatility, reducing side effects\n\nRESEARCH\nCJC-1295 and Growth Hormone Release\nCJC-1295 binds to GHRH receptors, triggering GH secretion while maintaining the body’s natural pulsatile rhythm. Research findings indicate that:\n\nA single dose of CJC-1295 can increase GH levels by 2-10 times.\nPeak GH secretion occurs around 2 hours post-administration and remains elevated for 6-8 days.\nUnlike exogenous GH injections, which can suppress natural GH production, CJC-1295 stimulates endogenous GH release, minimizing suppression risks.\n\nComparison: CJC-1295 vs. CJC-1295 DAC\n\n\n\nFeature\nCJC-1295 (No DAC)\nCJC-1295 DAC\n\n\nHalf-Life\n~30 minutes\n~8 days\n\n\nDosing Frequency\nMultiple injections daily\nWeekly\n\n\nMechanism\nShort-acting GHRH analogue\nBinds to albumin for sustained GH release\n\n\n\nThe DAC modification allows CJC-1295 to stay in circulation longer, preventing rapid degradation, and promoting longer-lasting GH stimulation.\nEffects on Muscle Growth\nAnimal studies suggest that CJC-1295 enhances lean body mass through:\n\nIncreased protein synthesis, supporting muscle hypertrophy and faster recovery.\nImproved nitrogen retention, aiding in muscle maintenance.\nEnhanced mitochondrial function, potentially boosting endurance and energy production.\n\nCJC-1295 and Fat Metabolism\nCJC-1295 has been linked to fat reduction and improved metabolic function by:\n\nEnhancing GH-induced fatty acid oxidation, leading to more efficient fat breakdown.\nReducing fat accumulation, particularly visceral and subcutaneous fat.\nImproving insulin sensitivity, which helps regulate glucose levels and metabolic efficiency.\n\nClinical studies indicate significant fat loss in subjects using CJC-1295 over 12-24 weeks.\nCJC-1295 and Sleep Quality\nResearch suggests that CJC-1295 may play a role in enhancing sleep cycles, particularly:\n\nIncreasing deep (slow-wave) sleep, crucial for muscle repair, memory consolidation, and recovery.\nModulating cortisol and stress hormones, leading to better relaxation and stress resilience.\n\nThese sleep-related benefits contribute to overall well-being, cognitive function, and physical recovery.\nCJC-1295 and Anti-Aging Potential\nDue to its ability to boost GH and IGF-1 levels, CJC-1295 has been explored for its potential in longevity and regenerative medicine. Benefits may include:\n\nImproved bone density, reducing age-related bone loss.\nEnhanced skin elasticity and collagen production, contributing to youthful skin.\nCognitive protection, potentially aiding in neuroprotection and memory retention.\n\nSTRUCTURE\n\nMolecular Formula: C₁₅₂H₂₅₂N₄₄O₄₂\nMolecular Weight: 3647.954 g\/mol\nAmino Acid Sequence: Tyr-D-Ala-Asp-Ala-Ile-Phe-Thr-Gln-Ser-Tyr-Arg-Lys-Val-Leu-Ala-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Leu-Ser-Arg-Lys-DAC\nCAS Registry Number: 446262-90-4\nPubChem Identifier: 91976842\n\nCITATIONS\n\nIonescu, M., \u0026amp; Frohman, L. A. Pulsatile secretion of growth hormone persists during continuous stimulation by CJC-1295. J. Clin. Endocrinol. Metab. (2006).\nAlba, M. et al. Once-daily administration of CJC-1295, a long-acting GHRH analog, normalizes growth in knockout mice. Am. J. Physiol. Endocrinol. Metab. (2006).\nVolpe, A. et al. Clinical use of growth hormone-releasing factor for induction of superovulation. Hum. Reprod. (1991).\nJetté, L. et al. hGRF1-29-Albumin Bioconjugates Activate the GRF Receptor on the Anterior Pituitary in Rats.Research Gate (2005).","brand":"Biogenesis Peptides","offers":[{"title":"Default Title","offer_id":50989561315561,"sku":"PS026","price":20000.0,"currency_code":"PKR","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0808\/6559\/1529\/files\/CJC-1295-DAC-5MG-scaled.jpg?v=1778509491"},{"product_id":"tb-500-5mg","title":"TB-500 5mg","description":"Overview\nTB-500 (Thymosin Beta-4 Fragment) is a synthetic version of Thymosin Beta-4 (Tβ4), a naturally occurring peptide involved in tissue repair, cell regeneration, and wound healing. It plays a crucial role in angiogenesis (blood vessel formation), reducing inflammation, and promoting cell migration. Research suggests that TB-500 may have applications in:\n✔ Accelerating wound healing\n✔ Improving muscle and tendon repair\n✔ Enhancing cardiovascular and neurological health\n✔ Reducing inflammation and fibrosis\n✔ Promoting stem cell migration and regeneration\nMechanism of Action\nTB-500 functions by modulating actin, a structural protein essential for cell movement and repair processes. Its biological effects include:\n\nUpregulating Actin Expression:\n\nStimulates cell migration and regeneration in injured tissues.\n\n\nPromoting Angiogenesis:\n\nIncreases blood vessel formation, improving circulation and oxygen delivery to damaged areas.\n\n\nReducing Fibrosis \u0026amp; Inflammation:\n\nRegulates inflammatory cytokines, preventing excessive scar tissue formation.\n\n\nActivating Stem Cells:\n\nEnhances stem cell differentiation, leading to improved muscle, skin, and organ repair.\n\n\n\nResearch \u0026amp; Potential Benefits\n1. Wound Healing \u0026amp; Tissue Regeneration\n\nTB-500 enhances wound closure and accelerates tissue regeneration.\nA study in the Journal of Investigative Dermatology found that Thymosin Beta-4 increased keratinocyte migration, promoting faster skin repair. (JID, 2013)\nIn animal models, TB-500 reduced wound healing time by 33% compared to controls.\n\n2. Muscle \u0026amp; Tendon Repair\n\nTB-500 is extensively researched for muscle and tendon regeneration, particularly in sports injuries and degenerative conditions.\nA study in Molecular Therapy indicated Thymosin Beta-4 reduced inflammation and fibrosis in damaged tendons, enhancing healing and function. (Molecular Therapy, 2015)\n\n3. Anti-Inflammatory \u0026amp; Fibrosis Prevention\n\nTB-500 regulates inflammatory cytokines (TNF-α, IL-6), reducing chronic inflammation.\nA study in American Journal of Pathology suggested Thymosin Beta-4 suppresses fibrosis in lung and liver diseases, making it a potential therapeutic candidate for pulmonary fibrosis and liver cirrhosis. (AJP, 2018)\n\n4. Cardiovascular \u0026amp; Neurological Protection\n\nNeuroprotection:\n\nStudies show TB-500 reduces brain inflammation and promotes neuron repair, suggesting potential benefits in stroke and traumatic brain injury (TBI) recovery.\n\n\nHeart Health:\n\nIn a Nature Medicine study, Thymosin Beta-4 was found to regenerate cardiac tissue post-heart attack. (Nature Medicine, 2012)\nTB-500 enhances coronary vessel formation, potentially reducing heart failure risk.\n\n\n\nClinical \u0026amp; Sports Applications\nDue to its regenerative properties, TB-500 is researched for:\n✔ Sports injuries (tendon, ligament, and muscle repair)\n✔ Wound healing \u0026amp; scar reduction\n✔ Heart \u0026amp; vascular repair (post-MI, stroke recovery)\n✔ Reducing inflammation in autoimmune conditions\n✔ Skin and organ regeneration (burns, ulcers, fibrosis)\nStructure \u0026amp; Composition\n\nSequence: Ac-Ser-Asp-Lys-Pro-Asp-Met-Ala-Glu-Ile-Gln-Glu-Lys-Gly-Glu-Ser-OH\nMolecular Formula: C₂₁₂H₃₅₄N₆₆O₇₈S\nMolecular Weight: 4963.49 g\/mol\nCAS Number: 77591-33-4\n\nCitations \u0026amp; References\n\nSmart, N. et al. “Thymosin Beta-4 promotes cardiac regeneration in myocardial infarction models,” Nature Medicine, 2012.\nPhilp, D. et al. “Thymosin Beta-4 accelerates wound healing by promoting keratinocyte migration,” Journal of Investigative Dermatology, 2013.\nSosne, G. et al. “Neuroprotective effects of Thymosin Beta-4 in experimental models of stroke and brain injury,”Brain Research, 2016.\nBanerjee, P. et al. “Thymosin Beta-4 modulates inflammation and fibrosis in lung and liver disease models,”American Journal of Pathology, 2018.\nGoldstein, A. et al. “Thymosin Beta-4 as a potential therapy for tendon and ligament injuries,” Molecular Therapy, 2015.\n\nConclusion\nTB-500 (Thymosin Beta-4 Fragment) is a powerful regenerative peptide known for its wound healing, tissue repair, and anti-inflammatory properties. Research supports its potential applications in muscle, tendon, cardiac, and neurological healing, making it an exciting candidate for therapeutic and sports medicine use.","brand":"Biogenesis Peptides","offers":[{"title":"Default Title","offer_id":50989561512169,"sku":"PS019","price":20000.0,"currency_code":"PKR","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0808\/6559\/1529\/files\/TB500-5mg-scaled.jpg?v=1778509496"},{"product_id":"cagrilintide-10mg","title":"Cagrilintide 10mg","description":"\u003cp\u003eOVERVIEW\u003cbr\u003e\nCagrilintide is a long-acting analogue of amylin, a peptide hormone that is naturally secreted alongside insulin. It has shown promise in obesity and type 2 diabetes treatment, with ongoing research exploring its potential applications in liver disease, alcohol-related liver conditions, and cardiovascular health.\u003cbr\u003e\nWhile there is speculation about its role in Alzheimer’s disease, no published studies have yet confirmed its effects in this area. Many trials have examined the combination of Cagrilintide and Semaglutide, suggesting that their combined use leads to enhanced and more sustainable weight loss results compared to either peptide alone.\u003cbr\u003e\nAlthough early research highlights its potential therapeutic benefits, human clinical trials remain limited, necessitating further investigation to confirm its safety and efficacy.\u003cbr\u003e\nRESEARCH\u003cbr\u003e\nCagrilintide and Amylin\u003cbr\u003e\nCagrilintide is a synthetic version of amylin, a hormone co-released with insulin from the pancreas. Amylin plays a crucial role in:\u003c\/p\u003e\n\n\u003cp\u003eRegulating blood sugar levels\u003cbr\u003e\nSlowing gastric emptying\u003cbr\u003e\nSignaling satiety (fullness) to the brain\u003c\/p\u003e\n\n\u003cp\u003eUnlike natural amylin, Cagrilintide is engineered to resist enzymatic breakdown, resulting in a longer half-life and extended duration of action.\u003cbr\u003e\nCagrilintide for Weight Management\u003cbr\u003e\nCagrilintide has been evaluated in clinical trials for its potential to support weight loss. In a notable study, individuals receiving Cagrilintide experienced a 6-11% reduction in body weight within just six weeks.\u003cbr\u003e\nWhen Cagrilintide is combined with Semaglutide, research suggests their weight loss benefits are synergistic rather than merely additive, leading to reductions in body weight of up to 17.1% within 20 weeks.\u003cbr\u003e\nCagrilintide and Diabetes Management\u003cbr\u003e\nCagrilintide supports diabetes treatment through several mechanisms:\u003c\/p\u003e\n\n\u003cp\u003eEnhancing insulin sensitivity\u003cbr\u003e\nReducing hemoglobin A1C (HbA1c) levels\u003cbr\u003e\nSuppressing glucagon secretion\u003c\/p\u003e\n\n\u003cp\u003eOne clinical study demonstrated a 2.2% decrease in HbA1c levels over a short treatment period, with the extended half-life of Cagrilintide allowing for more stable glucose regulation over time.\u003cbr\u003e\nCagrilintide and Alzheimer’s Disease\u003cbr\u003e\nResearch has linked amylin to amyloid-beta plaque accumulation, a hallmark of Alzheimer’s disease. High levels of natural amylin can form toxic fibrils that may contribute to cognitive decline.\u003cbr\u003e\nSome studies suggest that synthetic amylin analogues could aid in clearing amyloid plaques from the brain, but no direct research on Cagrilintide’s role in Alzheimer’s disease has been conducted yet.\u003cbr\u003e\nSTRUCTURE\u003c\/p\u003e\n\n\u003cp\u003eMolecular Formula: C₁₉₄H₃₁₂N₅₄O₅₉S₂\u003cbr\u003e\nMolecular Weight: 4409.01 g\/mol\u003cbr\u003e\nCAS Registry Number: 1415456-99-3\u003cbr\u003e\nAmino Acid Sequence: XKCNTATCATQRLAEFLRHSSNNFGPILPPTNVGSNTP\u003cbr\u003e\nPubChem Identifier: 171397054\u003c\/p\u003e\n\n\u003cp\u003eCITATIONS\u003c\/p\u003e\n\n\u003cp\u003ePittner, R. A. et al. Molecular physiology of amylin. Journal of Cellular Biochemistry (1994).\u003cbr\u003e\nShen, Y. et al. Structures of human insulin-degrading enzyme reveal a new substrate recognition mechanism.Nature (2006).\u003cbr\u003e\nLutz, T. A. Creating the amylin story. Appetite (2022).\u003cbr\u003e\nKruse, T. et al. Development of Cagrilintide, a Long-Acting Amylin Analogue. Journal of Medicinal Chemistry (2021).\u003cbr\u003e\nHay, D. L., \u0026amp; Pioszak, A. A. Receptor Activity-Modifying Proteins (RAMPs): New Insights and Roles. Annual Review of Pharmacology and Toxicology (2016).\u003cbr\u003e\nDehestani, B. et al. Amylin as a Future Obesity Treatment. Journal of Obesity \u0026amp; Metabolic Syndrome (2021).\u003cbr\u003e\nLau, D. C. W. et al. Once-weekly Cagrilintide for weight management: a multicenter, randomized, placebo-controlled trial. Lancet (2021).\u003cbr\u003e\nEnebo, L. B. et al. Safety, tolerability, and pharmacokinetics of Cagrilintide with Semaglutide. Lancet (2021).\u003cbr\u003e\nFrias, J. P. et al. Efficacy of co-administered Cagrilintide and Semaglutide in type 2 diabetes. The Lancet (2023).\u003cbr\u003e\nBailey, C. J. et al. Peptide-based therapies for obesity and type 2 diabetes. Peptides (2024).\u003cbr\u003e\nWarren, R. E. et al. Hypoglycemia and cognitive function. Diabetes Obesity and Metabolism (2005).\u003cbr\u003e\nZhang, S. et al. Cognitive dysfunction in diabetes: abnormal glucose metabolism in the brain. Frontiers in Endocrinology (2023).\u003cbr\u003e\nYang, Y. et al. Expert Consensus on Cognitive Dysfunction in Diabetes. Current Medical Science (2022).\u003cbr\u003e\nZhu, H. et al. Association of Plasma Amylin Concentration With Alzheimer Disease. JAMA Network Open (2019).\u003cbr\u003e\nQiu, W. et al. Association between amylin and amyloid-β peptides in plasma. PLoS One (2014).\u003c\/p\u003e","brand":"Biogenesis Peptides","offers":[{"title":"Default Title","offer_id":50989561807081,"sku":"PS011","price":20000.0,"currency_code":"PKR","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0808\/6559\/1529\/files\/CAGRILINTIDE-10MG-scaled.jpg?v=1778509503"}],"url":"https:\/\/f1kjgr-r5.myshopify.com\/collections\/bioregulators-repair-peptides-copy.oembed","provider":"Peptides Verse","version":"1.0","type":"link"}